Berita

Sekolah Staf Pimpinan BI Belajar dari Sleman

  Pemerintah Kab. Sleman hari Rabu, 29 Mei 2013 di Ruang rapat Sekda B menerima tamu dari Peserta Sekolah Staf Pimpinan Bank Indonesia (SESPIBI) Angkatan 31 jumlah 10 orang dengan pimpinan rombongan Arif Budi Santoso, maksud dan tujuan kunjungan di Kab. Sleman ini para peserta ingin belajar dan supaya menambah pengetahuan dan wawasan masalah pertanian dan ekonomi, dalam rangka mengikuti pendidikan sekolah pimpinan, yang saat ini dengan kaitan ketahanan pangan.

 

            Bupati Sleman dalam sambutan yang dibacakan oleh Sekda dr. H. Sunartono, M.Kes, menyampaikan,upayapemantapanketahanan  pangantidakhanyaberfokuspadapeningkatanketersediaanpangan,pemerataandistribusipangandenganhargaterjangkaudantercapainyapolakonsumsipanganyangaman,bergizidanberagam,namunjugameningkatkanperan serta masyarakatdanpihakswastadalammendukungketahananpangan. Dengan harapan masyarakat yang berkecimpung dalam penyediaan pangan juga memiliki kemampuan ekonomis untuk meningkatkan kesejahteraannya.

Di dalampemantapanketahananpangan,PemkabSlemantidakmengkonotasikanpadasekedarpemenuhankebutuhannasimasyarakatSleman,namunlebihluas lagi,yaitunasidanlaukpauknya sebagai sumberenergi yang dibutuhkanmanusia.Denganpemahaman tersebut,ketahananpangandiwujudkandalamkemampuanuntukmemenuhikebutuhanpanganmasyarakatSlemanyangberkualitas,mudahdidapatdanterjangkausesuaidenganbudayayangdimilikimasyarakatSleman.

Berkenaan dengan hal tersebut,  titik penekanan kebijakan di kabupaten Sleman yaitu aspek produksi, distribusi dan kemampuan daya beli masyarakat terhadap pangan. Oleh karena itu, untuk mewujudkan ketahanan pangan, tidak hanya berorientasi pada sektor pertanian saja, tetapi juga sektor perikanan dan peternakan sebagai sumber protein hewani. Sinergi lintas sektoral dan dukungan pemerintah pusat juga diperlukan untuk meningkatkan daya beli masyarakat.

            Programyangdilaksanakan oleh Pemkab Sleman didalam memantapkan ketersediaan pangan telahmampumempertahankansurpluspanganpokok.Pada Tahun 2012 Kabupaten Sleman mengalami Surplus berassebanyak 110.513 ton mengalami kenaikan 57,70%dibandingkan tahun 2011  yang hanya mencapai surplus 63.865 ton. Selain itu komiditi jagung mengalami surplus sebanyak 23.829 ton, dan ubi kayu sebanyak 3.452 ton. Kekurangan kebutuhan pangan terjadi pada komoditas Kacang tanah sebanyak 1.303 ton, kedelai sebanyak 19.047 ton, kacang hijau sebanyak  233 ton dan ubi jalar sebanyak 1.617 ton.

Demikian juga dengan produksi perikanan di tahun 2012 juga mengalami peningkatan. Produksi ikan konsumsi mencapai 21 ribu ton lebih (meningkat 19% dibanding tahun sebelumnya), benih ikan 902 juta ekor lebih atau naik 7,44%. Untuk ikan hias meningkat sekitar 11% dibanding tahun sebelumnya atau mencapai lebih dari 13 juta ekor.

konsumsi ikan perkapita di Kabupaten Sleman juga mengalami peningkatan, pada tahun 2011 konsumsi ikan perkapita sebesar 27,78 kg dan pada tahun 2012 meningkat menjadi 28,65 kg/kapita/tahun. Tingkat konsumsi ikan di Sleman secara rata-rata lebih tinggi dibandingkan dengan tingkat konsumsi ikan di Propinsi DIY yaitu sebesar 20,00kg.Peningkatan konsumsi ikan di Sleman ini dipicu oleh meningkatnya jumlah kelompok pembudidaya ikan, rumah makan/restoran ikan dan UKM yang mengolah berbagai produk olahan pangan berbahan baku ikan serta didukung peningkatan kesadaran masyarakat akan pentingnya kesehatan, yang mulai bergeser pada konsumsi makanan non kolesterol.

            Dalam rangka meningkatkan/ mempercepat tercapainya pola pangan harapan (PPH) dan menggalakkan pola pangan yang beragam, bergizi seimbang dan aman (B2SA) di masyarakat, pemerintah pusat meluncurkan Program Percepatan Penganekaragaman Konsumsi Pangan. Hingga tahun 2012 telah diterimakan dana bansos bagi 20 kelompok wanita tani (KWT) yang tersebar di 20 desa se Kabupaten Sleman masing-masing sebesar Rp. 16.000.000.

Sebagai bentuk dukungan pemerintah terhadap ketahanan pangan lokal, sejak tahun2008laluPemkabSlemanjugatelahmenginstruksikankepadasemuainstansidilingkunganPemkabSlemanagarmenyajikanmakananlokalpadasetiapacarapertemuandankursus/pelatihan.InstruksiinidiwujudkandalamSuratEdaranSekretarisDaerahnomor521/00876tentangPenggunaanPanganLokalDalamPertemuan/Rapat/Pelatihan.Selainitujugamelakukankampanyeagarmasyarakatmenggunakanproduklokaldanjugamengenalkanproduklokalproduklokaldisetiappamerandanlomba.Dalam memberdayakan dan mengembangkan  bidang pertanian, Pemkab Sleman senantiasa berorientasi pada pembinaan pertanian secara berkelompok yaitu melalui kelompok-kelompok tani, kelompok ternak maupun kelompok perikanan. Strategi tersebut dilakukan untuk mengefektifkan pembinaan, pemberdayaan para petani dan sekaligus  memunculkan kepedulian sesama petani untuk maju bersama. Didalam melakukan fasilitasi penyaluran perguliran dan penguatan modal kerja, sarana dan prasarana kerja, Pemkab Sleman selalu menggunakan kelompok yang sudah terbentuk tersebut.  Bahkan dengan langkah ini , dapat mengoptimalkan kesinambungan perguliran dan penguatan modal kerja.

Kebijakan lain yang diterapkan di Sleman adalah Pemkab  memberikan kebebasan kepada petani untuk memilih jenis komoditas dan budidaya yang akan ditekuninya sesuai dengan minatnya masing-masing.  Pemkab Sleman melalui Dinas pertanian hanya memberikan fasilitasi dan pembinaan. Salah satu contoh kebijakan pemkab untuk mendorong berkembangnya  kegiatan perikanan adalah diperbolehkannya pemanfaatan tanah-tanah kas desa untuk digunakan sebagai kolam ikan dengan cara sewa. Selain itu juga fasilitasi pemggunaan ekskavator untuk pembuatan kolam ikan secara berkelompok tanpa dipungut biaya.

Comment here